![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.9: TFIIH domain [110272] (2 proteins) |
![]() | Protein TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain [110273] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [110274] (3 PDB entries) Uniprot P32780 1-108 |
![]() | Domain d2rukb_: 2ruk B: [260438] automated match to d1pfja_ |
PDB Entry: 2ruk (more details)
SCOPe Domain Sequences for d2rukb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rukb_ b.55.1.9 (B:) TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} matsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispegk akiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan
Timeline for d2rukb_: