SCOPe 2.06: Domain d4rhwe_: 4rhw E:

Lineage for d4rhwe_ (4rhw E:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.77: DEATH domain [47985] (1 superfamily)
   6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.77.1: DEATH domain [47986] (5 families)

5. Family a.77.1.3: Caspase recruitment domain, CARD [81313] (6 proteins)

6. Protein automated matches [190343] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187170] (3 PDB entries)

8. Domain d4rhwe_: 4rhw E: [260435]
   Other proteins in same PDB: d4rhwa_, d4rhwb_, d4rhwc_, d4rhwd_
   automated match to d3ygsp_
   complexed with cl, so4

Details for d4rhwe_

PDB Entry: 4rhw, 2.1 Å

PDB Description: crystal structure of apaf-1 card and caspase-9 card complex

PDB Compounds: (E:) Caspase-9

SCOPe Domain Sequences for d4rhwe_:

Sequence; same for both SEQRES and ATOM records:

>d4rhwe_ a.77.1.3 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdeadrrllrrcrlrlveelqvdqlwdallsrelfrphmiediqragsgsrrdqarqlii
dletrgsqalplfiscledtgqdmlasflrtnrqa

Timeline for d4rhwe_:

• d4rhwe_ first appeared in SCOPe 2.04
  
• d4rhwe_ appears in SCOPe 2.05
  
• d4rhwe_ appears in SCOPe 2.07
  
• d4rhwe_ appears in the current release, SCOPe 2.08