SCOPe 2.05: Domain d4rhwc_: 4rhw C:

Lineage for d4rhwc_ (4rhw C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.77: DEATH domain [47985] (1 superfamily)
   6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.77.1: DEATH domain [47986] (5 families)

5. Family a.77.1.3: Caspase recruitment domain, CARD [81313] (6 proteins)

6. Protein Apoptotic protease activating factor 1, APAF-1 [47997] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47998] (6 PDB entries)

8. Domain d4rhwc_: 4rhw C: [260432]
   Other proteins in same PDB: d4rhwe_, d4rhwf_
   automated match to d1c15a_
   complexed with cl, so4

Details for d4rhwc_

PDB Entry: 4rhw, 2.1 Å

PDB Description: crystal structure of apaf-1 card and caspase-9 card complex

PDB Compounds: (C:) Apoptotic protease-activating factor 1

SCOPe Domain Sequences for d4rhwc_:

Sequence; same for both SEQRES and ATOM records:

>d4rhwc_ a.77.1.3 (C:) Apoptotic protease activating factor 1, APAF-1 {Human (Homo sapiens) [TaxId: 9606]}
mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi
lkkdndsyvsfynallhegykdlaallhdgipvvs

Timeline for d4rhwc_:

• d4rhwc_ first appeared in SCOPe 2.04
  
• d4rhwc_ appears in SCOPe 2.06
  
• d4rhwc_ appears in the current release, SCOPe 2.08