SCOPe 2.08: Domain d4rhwb_: 4rhw B:

Lineage for d4rhwb_ (4rhw B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.77: DEATH domain [47985] (1 superfamily)
   6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.77.1: DEATH domain [47986] (5 families)

5. Family a.77.1.3: Caspase recruitment domain, CARD [81313] (7 proteins)

6. Protein Apoptotic protease activating factor 1, APAF-1 [47997] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47998] (7 PDB entries)

8. Domain d4rhwb_: 4rhw B: [260431]
   Other proteins in same PDB: d4rhwe_, d4rhwf_
   automated match to d1cy5a_
   complexed with cl, so4

Details for d4rhwb_

PDB Entry: 4rhw, 2.1 Å

PDB Description: crystal structure of apaf-1 card and caspase-9 card complex

PDB Compounds: (B:) Apoptotic protease-activating factor 1

SCOPe Domain Sequences for d4rhwb_:

Sequence; same for both SEQRES and ATOM records:

>d4rhwb_ a.77.1.3 (B:) Apoptotic protease activating factor 1, APAF-1 {Human (Homo sapiens) [TaxId: 9606]}
mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi
lkkdndsyvsfynallhegykdlaallhdgip

Timeline for d4rhwb_:

• d4rhwb_ first appeared in SCOPe 2.04
  
• d4rhwb_ appears in SCOPe 2.07