Lineage for d4rhwb_ (4rhw B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718930Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2718931Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2719000Family a.77.1.3: Caspase recruitment domain, CARD [81313] (7 proteins)
  6. 2719001Protein Apoptotic protease activating factor 1, APAF-1 [47997] (1 species)
  7. 2719002Species Human (Homo sapiens) [TaxId:9606] [47998] (7 PDB entries)
  8. 2719007Domain d4rhwb_: 4rhw B: [260431]
    Other proteins in same PDB: d4rhwe_, d4rhwf_
    automated match to d1cy5a_
    complexed with cl, so4

Details for d4rhwb_

PDB Entry: 4rhw (more details), 2.1 Å

PDB Description: crystal structure of apaf-1 card and caspase-9 card complex
PDB Compounds: (B:) Apoptotic protease-activating factor 1

SCOPe Domain Sequences for d4rhwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rhwb_ a.77.1.3 (B:) Apoptotic protease activating factor 1, APAF-1 {Human (Homo sapiens) [TaxId: 9606]}
mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi
lkkdndsyvsfynallhegykdlaallhdgip

SCOPe Domain Coordinates for d4rhwb_:

Click to download the PDB-style file with coordinates for d4rhwb_.
(The format of our PDB-style files is described here.)

Timeline for d4rhwb_: