| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
| Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
| Protein automated matches [190139] (27 species) not a true protein |
| Species Viridovipera stejnegeri [TaxId:39682] [194681] (3 PDB entries) |
| Domain d4rfpb_: 4rfp B: [260426] automated match to d4h0qa_ complexed with peg |
PDB Entry: 4rfp (more details), 1.6 Å
SCOPe Domain Sequences for d4rfpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rfpb_ a.133.1.2 (B:) automated matches {Viridovipera stejnegeri [TaxId: 39682]}
nlmqfellimkvagrsgivwysdygcfcgkgghgrpqdatdrccfvhdccygkvngcdpk
edfyryssnngdivceannpctkeicecdkaaaicfrdnkdtydnkywnipmescqesep
c
Timeline for d4rfpb_: