Lineage for d4r8sa_ (4r8s A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2502162Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2502163Protein automated matches [190689] (81 species)
    not a true protein
  7. 2502246Species Dengue virus 3 [TaxId:11069] [260424] (4 PDB entries)
  8. 2502249Domain d4r8sa_: 4r8s A: [260425]
    automated match to d2oxta_
    complexed with sfg

Details for d4r8sa_

PDB Entry: 4r8s (more details), 1.48 Å

PDB Description: Dengue serotype 3 methyltransferase bound to Sinefungin
PDB Compounds: (A:) nonstructural protein ns5

SCOPe Domain Sequences for d4r8sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r8sa_ c.66.1.0 (A:) automated matches {Dengue virus 3 [TaxId: 11069]}
etlgekwkkklnqlsrkefdlykksgitevdrteakeglkrgetthhavsrgsaklqwfv
ernmvipegrvidlgcgrggwsyycaglkkvtevrgytkggpgheepvpmstygwnivkl
msgkdvfylppekcdtllcdigesspsptveesrtirvlkmvepwlknnqfcikvlnpym
ptviehlerlqrkhggmlvrnplsrnsthemywisngtgnivssvnmvsrlllnrftmth
rrptiekdvdlgagtr

SCOPe Domain Coordinates for d4r8sa_:

Click to download the PDB-style file with coordinates for d4r8sa_.
(The format of our PDB-style files is described here.)

Timeline for d4r8sa_: