Lineage for d1acbe_ (1acb E:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2055878Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)
  7. 2055879Species Cow (Bos taurus) [TaxId:9913] [50523] (60 PDB entries)
    Uniprot P00766
  8. 2055925Domain d1acbe_: 1acb E: [26040]
    Other proteins in same PDB: d1acbi_

Details for d1acbe_

PDB Entry: 1acb (more details), 2 Å

PDB Description: crystal and molecular structure of the bovine alpha-chymotrypsin-eglin c complex at 2.0 angstroms resolution
PDB Compounds: (E:) alpha-chymotrypsin

SCOPe Domain Sequences for d1acbe_:

Sequence, based on SEQRES records: (download)

>d1acbe_ b.47.1.2 (E:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
tlaan

Sequence, based on observed residues (ATOM records): (download)

>d1acbe_ b.47.1.2 (E:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsglivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtt
sdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavc
lpsasddfaagttcvttgwgltryantpdrlqqaslpllsntnckkywgtkikdamicag
asgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaa
n

SCOPe Domain Coordinates for d1acbe_:

Click to download the PDB-style file with coordinates for d1acbe_.
(The format of our PDB-style files is described here.)

Timeline for d1acbe_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1acbi_