SCOPe 2.08: Domain d7gch.1: 7gch E:,F:,G:

Lineage for d7gch.1 (7gch E:,F:,G:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50523] (66 PDB entries)
   Uniprot P00766

8. Domain d7gch.1: 7gch E:,F:,G: [26039]
   complexed with lpf

Details for d7gch.1

PDB Entry: 7gch, 1.8 Å

PDB Description: structure of chymotrypsin-*trifluoromethyl ketone inhibitor complexes. comparison of slowly and rapidly equilibrating inhibitors

PDB Compounds: (E:) gamma-chymotrypsin a, (F:) gamma-chymotrypsin a, (G:) gamma-chymotrypsin a

SCOPe Domain Sequences for d7gch.1:

Sequence; same for both SEQRES and ATOM records:

>g7gch.1 b.47.1.2 (E:,F:,G:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtts
dvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavcl
psasddfaagttcvttgwgltryXtpdrlqqaslpllsntnckkywgtkikdamicagas
gvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

Timeline for d7gch.1:

• d7gch.1 first appeared (with stable ids) in SCOP 1.55, called d7gch__
  
• d7gch.1 appears in SCOPe 2.07