Lineage for d4qplb_ (4qpl B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1642804Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1642805Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1642806Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1642988Protein automated matches [190124] (12 species)
    not a true protein
  7. 1642998Species Human (Homo sapiens) [TaxId:9606] [186848] (29 PDB entries)
  8. 1643015Domain d4qplb_: 4qpl B: [260380]
    automated match to d2yhob_
    complexed with v3l, zn

Details for d4qplb_

PDB Entry: 4qpl (more details), 1.9 Å

PDB Description: crystal structure of rnf146(ring-wwe)/ubch5a/iso-adpr complex
PDB Compounds: (B:) ubiquitin-conjugating enzyme e2 d1

SCOPe Domain Sequences for d4qplb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qplb_ d.20.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hamalkriqkelsdlqrdppahcsagpvgddlfhwqatimgppdsayqggvffltvhfpt
dypfkppkiafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpnpddp
lvpdiaqiyksdkekynrharewtqkyam

SCOPe Domain Coordinates for d4qplb_:

Click to download the PDB-style file with coordinates for d4qplb_.
(The format of our PDB-style files is described here.)

Timeline for d4qplb_: