Lineage for d1vgc.1 (1vgc A:,B:,C:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298675Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 298676Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 298774Family b.47.1.2: Eukaryotic proteases [50514] (43 proteins)
  6. 298775Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)
  7. 298776Species Cow (Bos taurus) [TaxId:9913] [50523] (46 PDB entries)
  8. 298798Domain d1vgc.1: 1vgc A:,B:,C: [26038]
    complexed with so4, v36

Details for d1vgc.1

PDB Entry: 1vgc (more details), 1.9 Å

PDB Description: gamma-chymotrypsin l-para-chloro-1-acetamido boronic acid inhibitor complex

SCOP Domain Sequences for d1vgc.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1vgc.1 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)}
cgvpaiqpvlXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
sasddfaagttcvttgwgltryXtpdrlqqaslpllsntnckkywgtkikdamicagasg
vsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

SCOP Domain Coordinates for d1vgc.1:

Click to download the PDB-style file with coordinates for d1vgc.1.
(The format of our PDB-style files is described here.)

Timeline for d1vgc.1: