Lineage for d4q0ee1 (4q0e E:3-178)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2903431Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2903432Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain [53610] (2 species)
  7. 2903433Species Cryptosporidium hominis [TaxId:237895] [102636] (15 PDB entries)
    Uniprot Q5CGA3 Q27552
  8. 2903458Domain d4q0ee1: 4q0e E:3-178 [260374]
    Other proteins in same PDB: d4q0ea2, d4q0eb2, d4q0ec2, d4q0ed2, d4q0ee2
    automated match to d1seja1
    complexed with 2xb, ndp, ufp

Details for d4q0ee1

PDB Entry: 4q0e (more details), 2.78 Å

PDB Description: crystal structure of ts-dhfr from cryptosporidium hominis in complex with nadph, fdump and 2-amino-4-oxo-4,7-dihydro-pyrrolo[2,3- d]pyrimidine-methyl-phenyl-l-glutamic acid.
PDB Compounds: (E:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d4q0ee1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q0ee1 c.71.1.1 (E:3-178) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis [TaxId: 237895]}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekq

SCOPe Domain Coordinates for d4q0ee1:

Click to download the PDB-style file with coordinates for d4q0ee1.
(The format of our PDB-style files is described here.)

Timeline for d4q0ee1: