![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
![]() | Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain [53610] (2 species) |
![]() | Species Cryptosporidium hominis [TaxId:237895] [102636] (15 PDB entries) Uniprot Q5CGA3 Q27552 |
![]() | Domain d4q0ee1: 4q0e E:3-178 [260374] Other proteins in same PDB: d4q0ea2, d4q0eb2, d4q0ec2, d4q0ed2, d4q0ee2 automated match to d1seja1 complexed with 2xb, ndp, ufp |
PDB Entry: 4q0e (more details), 2.78 Å
SCOPe Domain Sequences for d4q0ee1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q0ee1 c.71.1.1 (E:3-178) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis [TaxId: 237895]} eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekq
Timeline for d4q0ee1: