Lineage for d4pe1b_ (4pe1 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319424Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2319425Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2319458Family a.39.1.2: S100 proteins [47478] (2 protein domains)
    dimer: subunits are made of two EF-hands
  6. 2319459Protein Calcyclin (S100) [47479] (17 species)
  7. 2319460Species Cow (Bos taurus), s100b [TaxId:9913] [47482] (26 PDB entries)
  8. 2319470Domain d4pe1b_: 4pe1 B: [260361]
    automated match to d1cfpa_
    complexed with ca, dcd

Details for d4pe1b_

PDB Entry: 4pe1 (more details), 1.58 Å

PDB Description: crystal structure of calcium-loaded s100b bound to sc124
PDB Compounds: (B:) Protein S100-B

SCOPe Domain Sequences for d4pe1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pe1b_ a.39.1.2 (B:) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]}
mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldsdgdgecdfqefmafvamittacheffe

SCOPe Domain Coordinates for d4pe1b_:

Click to download the PDB-style file with coordinates for d4pe1b_.
(The format of our PDB-style files is described here.)

Timeline for d4pe1b_: