Lineage for d4npna_ (4npn A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933161Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)
  8. 2933192Domain d4npna_: 4npn A: [260331]
    automated match to d2ekec_

Details for d4npna_

PDB Entry: 4npn (more details), 1.63 Å

PDB Description: Crystal structure of human tetra-SUMO-2
PDB Compounds: (A:) Small ubiquitin-related modifier 2

SCOPe Domain Sequences for d4npna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4npna_ d.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaql
emededtidvf

SCOPe Domain Coordinates for d4npna_:

Click to download the PDB-style file with coordinates for d4npna_.
(The format of our PDB-style files is described here.)

Timeline for d4npna_: