Lineage for d4my6b1 (4my6 B:1-111)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2071584Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2071585Protein automated matches [190052] (6 species)
    not a true protein
  7. 2071626Species Human (Homo sapiens) [TaxId:9606] [186914] (54 PDB entries)
  8. 2071641Domain d4my6b1: 4my6 B:1-111 [260330]
    Other proteins in same PDB: d4my6b2
    automated match to d2jp2a_
    complexed with 3vh, br

Details for d4my6b1

PDB Entry: 4my6 (more details), 1.7 Å

PDB Description: enah-evh1 in complex with peptidomimetic low-molecular weight inhibitor ac-[2-cl-f]-[prom-2]-[prom-1]-oh
PDB Compounds: (B:) Protein enabled homolog

SCOPe Domain Sequences for d4my6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4my6b1 b.55.1.0 (B:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvi
ncaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevl

SCOPe Domain Coordinates for d4my6b1:

Click to download the PDB-style file with coordinates for d4my6b1.
(The format of our PDB-style files is described here.)

Timeline for d4my6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4my6b2
View in 3D
Domains from other chains:
(mouse over for more information)
d4my6a_