Class b: All beta proteins [48724] (176 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186914] (32 PDB entries) |
Domain d4my6b_: 4my6 B: [260330] automated match to d2jp2a_ complexed with 3vh, br |
PDB Entry: 4my6 (more details), 1.7 Å
SCOPe Domain Sequences for d4my6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4my6b_ b.55.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} smseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvv incaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevl
Timeline for d4my6b_: