Lineage for d4my6b_ (4my6 B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1550800Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1550801Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1551373Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 1551374Protein automated matches [190052] (5 species)
    not a true protein
  7. 1551393Species Human (Homo sapiens) [TaxId:9606] [186914] (32 PDB entries)
  8. 1551396Domain d4my6b_: 4my6 B: [260330]
    automated match to d2jp2a_
    complexed with 3vh, br

Details for d4my6b_

PDB Entry: 4my6 (more details), 1.7 Å

PDB Description: enah-evh1 in complex with peptidomimetic low-molecular weight inhibitor ac-[2-cl-f]-[prom-2]-[prom-1]-oh
PDB Compounds: (B:) Protein enabled homolog

SCOPe Domain Sequences for d4my6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4my6b_ b.55.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvv
incaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevl

SCOPe Domain Coordinates for d4my6b_:

Click to download the PDB-style file with coordinates for d4my6b_.
(The format of our PDB-style files is described here.)

Timeline for d4my6b_: