SCOPe 2.01: Domain d4cha.2: 4cha E:,F:,G:

Lineage for d4cha.2 (4cha E:,F:,G:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50523] (57 PDB entries)
   Uniprot P00766

8. Domain d4cha.2: 4cha E:,F:,G: [26033]

Details for d4cha.2

PDB Entry: 4cha, 1.68 Å

PDB Description: structure of alpha-*chymotrypsin refined at 1.68 angstroms resolution

PDB Compounds: (E:) alpha-chymotrypsin a, (F:) alpha-chymotrypsin a, (G:) alpha-chymotrypsin a

SCOPe Domain Sequences for d4cha.2:

Sequence; same for both SEQRES and ATOM records:

>g4cha.2 b.47.1.2 (E:,F:,G:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
sasddfaagttcvttgwgltryXantpdrlqqaslpllsntnckkywgtkikdamicaga
sgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

Timeline for d4cha.2:

• d4cha.2 first appeared (with stable ids) in SCOP 1.55, called d4chab_
  
• d4cha.2 appears in SCOP 1.75
  
• d4cha.2 appears in SCOPe 2.02
  
• d4cha.2 appears in the current release, SCOPe 2.08