Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins) automatically mapped to Pfam PF00182 |
Protein automated matches [190455] (6 species) not a true protein |
Species Hevea brasiliensis [TaxId:3981] [259210] (1 PDB entry) |
Domain d4msta_: 4mst A: [260325] automated match to d3w3ea_ complexed with cl |
PDB Entry: 4mst (more details), 1.93 Å
SCOPe Domain Sequences for d4msta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4msta_ d.2.1.1 (A:) automated matches {Hevea brasiliensis [TaxId: 3981]} siisrstfeemlkhrndaacpakgfytydafisaakafpafgttgdvdtckreiaaffgq tshattggwptapdgpyawgycykeelnqassycspspaypcapgkkyygrgpiqlswny nygqcgqalgldllnnpdlvatdrvisfkaaiwfwmtpqfpkpschdvitgqwsptghdi sagrapgygvitniingglecgrgwdarvedrigfykrycdmfavgygsnldcynqtpfg l
Timeline for d4msta_: