Lineage for d4msta_ (4mst A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1632226Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1632227Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1632228Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins)
    automatically mapped to Pfam PF00182
  6. 1632236Protein automated matches [190455] (6 species)
    not a true protein
  7. 1632248Species Hevea brasiliensis [TaxId:3981] [259210] (1 PDB entry)
  8. 1632249Domain d4msta_: 4mst A: [260325]
    automated match to d3w3ea_
    complexed with cl

Details for d4msta_

PDB Entry: 4mst (more details), 1.93 Å

PDB Description: Crystal Structure of a putative catalytic domain of a chitinase-like protein (HbCLP1) from Hevea brasiliensis
PDB Compounds: (A:) Class I chitinase

SCOPe Domain Sequences for d4msta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4msta_ d.2.1.1 (A:) automated matches {Hevea brasiliensis [TaxId: 3981]}
siisrstfeemlkhrndaacpakgfytydafisaakafpafgttgdvdtckreiaaffgq
tshattggwptapdgpyawgycykeelnqassycspspaypcapgkkyygrgpiqlswny
nygqcgqalgldllnnpdlvatdrvisfkaaiwfwmtpqfpkpschdvitgqwsptghdi
sagrapgygvitniingglecgrgwdarvedrigfykrycdmfavgygsnldcynqtpfg
l

SCOPe Domain Coordinates for d4msta_:

Click to download the PDB-style file with coordinates for d4msta_.
(The format of our PDB-style files is described here.)

Timeline for d4msta_: