SCOPe 2.08: Domain d4msta_: 4mst A:

Lineage for d4msta_ (4mst A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins)
   automatically mapped to Pfam PF00182

6. Protein automated matches [190455] (7 species)
   not a true protein

7. Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [259210] (1 PDB entry)

8. Domain d4msta_: 4mst A: [260325]
   automated match to d3w3ea_
   complexed with cl

Details for d4msta_

PDB Entry: 4mst, 1.93 Å

PDB Description: Crystal Structure of a putative catalytic domain of a chitinase-like protein (HbCLP1) from Hevea brasiliensis

PDB Compounds: (A:) Class I chitinase

SCOPe Domain Sequences for d4msta_:

Sequence; same for both SEQRES and ATOM records:

>d4msta_ d.2.1.1 (A:) automated matches {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}
siisrstfeemlkhrndaacpakgfytydafisaakafpafgttgdvdtckreiaaffgq
tshattggwptapdgpyawgycykeelnqassycspspaypcapgkkyygrgpiqlswny
nygqcgqalgldllnnpdlvatdrvisfkaaiwfwmtpqfpkpschdvitgqwsptghdi
sagrapgygvitniingglecgrgwdarvedrigfykrycdmfavgygsnldcynqtpfg
l

Timeline for d4msta_:

• d4msta_ first appeared in SCOPe 2.04
  
• d4msta_ appears in SCOPe 2.07