Lineage for d4mq4a_ (4mq4 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1611695Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1611696Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1611983Family c.66.1.15: Arylamine N-methyltransferase [69547] (3 proteins)
    automatically mapped to Pfam PF01234
  6. 1612005Protein automated matches [190168] (1 species)
    not a true protein
  7. 1612006Species Human (Homo sapiens) [TaxId:9606] [186895] (33 PDB entries)
  8. 1612046Domain d4mq4a_: 4mq4 A: [260324]
    automated match to d2an3b_
    complexed with 2d5, trs

Details for d4mq4a_

PDB Entry: 4mq4 (more details), 2.2 Å

PDB Description: crystal structure of hpnmt in complex with bisubstrate inhibitor n-(3- ((((2s,3s,4r,5r)-5-(6-amino-9h-purin-9-yl)-3,4- dihydroxytetrahydrofuran-2-yl)methyl)thio)propyl)-1,2,3,4- tetrahydroisoquinoline-3-carboxamide
PDB Compounds: (A:) Phenylethanolamine N-methyltransferase

SCOPe Domain Sequences for d4mq4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mq4a_ c.66.1.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apgqaavasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgrtli
digsgptvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacliegk
gecwqdkerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlasfqr
aldhittllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrty
impahlqtgvddvkgvffawaqkv

SCOPe Domain Coordinates for d4mq4a_:

Click to download the PDB-style file with coordinates for d4mq4a_.
(The format of our PDB-style files is described here.)

Timeline for d4mq4a_: