SCOPe 2.08: Domain d4meza_: 4mez A:

Lineage for d4meza_ (4mez A:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Escherichia coli, TEM-1 [TaxId:562] [56607] (63 PDB entries)

8. Domain d4meza_: 4mez A: [260322]
   automated match to d1li9a_
   complexed with cl, gol, so4; mutant

Details for d4meza_

PDB Entry: 4mez, 2.05 Å

PDB Description: crystal structure of m68l/m69t double mutant tem-1

PDB Compounds: (A:) Beta-lactamase TEM

SCOPe Domain Sequences for d4meza_:

Sequence; same for both SEQRES and ATOM records:

>d4meza_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpltstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

Timeline for d4meza_:

• d4meza_ first appeared in SCOPe 2.04
  
• d4meza_ appears in SCOPe 2.07