Lineage for d4chaa_ (4cha A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 14910Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (2 species)
  7. 14911Species Cow (Bos taurus) [TaxId:9913] [50523] (42 PDB entries)
  8. 14926Domain d4chaa_: 4cha A: [26032]

Details for d4chaa_

PDB Entry: 4cha (more details), 1.68 Å

PDB Description: structure of alpha-*chymotrypsin refined at 1.68 angstroms resolution

SCOP Domain Sequences for d4chaa_:

Sequence, based on SEQRES records: (download)

>d4chaa_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)}
cgvpaiqpvlsglxxivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
vclpsasddfaagttcvttgwgltryxxantpdrlqqaslpllsntnckkywgtkikdam
icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
tlaan

Sequence, based on observed residues (ATOM records): (download)

>d4chaa_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)}
cgvpaiqpvlsivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
sasddfaagttcvttgwgltryantpdrlqqaslpllsntnckkywgtkikdamicagas
gvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

SCOP Domain Coordinates for d4chaa_:

Click to download the PDB-style file with coordinates for d4chaa_.
(The format of our PDB-style files is described here.)

Timeline for d4chaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4chab_