![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) ![]() there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members |
![]() | Family c.23.14.1: N-deoxyribosyltransferase [52310] (2 proteins) |
![]() | Protein Purine transdeoxyribosylase [102244] (1 species) class I N-deoxyribosyltransferase |
![]() | Species Lactobacillus helveticus [TaxId:1587] [102245] (6 PDB entries) |
![]() | Domain d4meja_: 4mej A: [260318] automated match to d1s2da_ complexed with 28y, so4 |
PDB Entry: 4mej (more details), 2.1 Å
SCOPe Domain Sequences for d4meja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4meja_ c.23.14.1 (A:) Purine transdeoxyribosylase {Lactobacillus helveticus [TaxId: 1587]} mkavvptgkiylgspfysdaqreraakakellaknpsiahvffpfddgftdpdeknpeig girsmvwrdatyqndltgisnatcgvflydmdqlddgsafeigfmramhkpvilvpfteh pekekkmnlmiaqgvttiidgntefekladynfnecpsnpvrgygiy
Timeline for d4meja_: