Lineage for d4meja_ (4mej A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858401Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 2858402Family c.23.14.1: N-deoxyribosyltransferase [52310] (2 proteins)
  6. 2858420Protein Purine transdeoxyribosylase [102244] (1 species)
    class I N-deoxyribosyltransferase
  7. 2858421Species Lactobacillus helveticus [TaxId:1587] [102245] (6 PDB entries)
  8. 2858437Domain d4meja_: 4mej A: [260318]
    automated match to d1s2da_
    complexed with 28y, so4

Details for d4meja_

PDB Entry: 4mej (more details), 2.1 Å

PDB Description: crystal structure of lactobacillus helveticus purine deoxyribosyl transferase (pdt) with the tricyclic purine 8,9-dihydro-9- oxoimidazo[2,1-b]purine (n2,3-ethenoguanine)
PDB Compounds: (A:) Nucleoside deoxyribosyltransferase

SCOPe Domain Sequences for d4meja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4meja_ c.23.14.1 (A:) Purine transdeoxyribosylase {Lactobacillus helveticus [TaxId: 1587]}
mkavvptgkiylgspfysdaqreraakakellaknpsiahvffpfddgftdpdeknpeig
girsmvwrdatyqndltgisnatcgvflydmdqlddgsafeigfmramhkpvilvpfteh
pekekkmnlmiaqgvttiidgntefekladynfnecpsnpvrgygiy

SCOPe Domain Coordinates for d4meja_:

Click to download the PDB-style file with coordinates for d4meja_.
(The format of our PDB-style files is described here.)

Timeline for d4meja_: