Lineage for d4kpza1 (4kpz A:4-251)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1868080Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1868081Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1868928Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 1868929Protein automated matches [190951] (23 species)
    not a true protein
  7. 1868969Species Haemophilus influenzae [TaxId:727] [231294] (14 PDB entries)
  8. 1868979Domain d4kpza1: 4kpz A:4-251 [260309]
    Other proteins in same PDB: d4kpza2
    automated match to d2v0ha1
    complexed with 1sf, mg, pg4, so4

Details for d4kpza1

PDB Entry: 4kpz (more details), 2.09 Å

PDB Description: Hin GlmU bound to a small molecule fragment
PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d4kpza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kpza1 c.68.1.0 (A:4-251) automated matches {Haemophilus influenzae [TaxId: 727]}
kalsavilaagkgtrmysdlpkvlhtiagkpmvkhvidtahqlgsenihliyghggdlmr
thlaneqvnwvlqteqlgtahavqqaapffkdnenivvlygdaplitketleklieakpe
ngialltvnldnptgygriirengnvvaiveqkdanaeqlnikevntgvmvsdgasfkkw
larvgnnnaqgeyyltdlialanqdncqvvavqatdvmevegannrlqlaaleryfqnkq
askllleg

SCOPe Domain Coordinates for d4kpza1:

Click to download the PDB-style file with coordinates for d4kpza1.
(The format of our PDB-style files is described here.)

Timeline for d4kpza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4kpza2