![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
![]() | Family c.68.1.0: automated matches [191551] (1 protein) not a true family |
![]() | Protein automated matches [190951] (34 species) not a true protein |
![]() | Species Haemophilus influenzae [TaxId:727] [231294] (14 PDB entries) |
![]() | Domain d4kpza1: 4kpz A:4-251 [260309] Other proteins in same PDB: d4kpza2 automated match to d2v0ha1 complexed with 1sf, mg, pg4, so4 |
PDB Entry: 4kpz (more details), 2.09 Å
SCOPe Domain Sequences for d4kpza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kpza1 c.68.1.0 (A:4-251) automated matches {Haemophilus influenzae [TaxId: 727]} kalsavilaagkgtrmysdlpkvlhtiagkpmvkhvidtahqlgsenihliyghggdlmr thlaneqvnwvlqteqlgtahavqqaapffkdnenivvlygdaplitketleklieakpe ngialltvnldnptgygriirengnvvaiveqkdanaeqlnikevntgvmvsdgasfkkw larvgnnnaqgeyyltdlialanqdncqvvavqatdvmevegannrlqlaaleryfqnkq askllleg
Timeline for d4kpza1: