Lineage for d4d1pa_ (4d1p A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1683350Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 1683351Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 1683352Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 1683973Protein automated matches [190421] (5 species)
    not a true protein
  7. 1684005Species Human (Homo sapiens) [TaxId:9606] [187302] (6 PDB entries)
  8. 1684006Domain d4d1pa_: 4d1p A: [260306]
    automated match to d3e7sa_
    complexed with act, btb, gd, gol, h4b, hem, q16, zn

Details for d4d1pa_

PDB Entry: 4d1p (more details), 1.73 Å

PDB Description: structure of human endothelial nitric oxide synthase heme domain in complex with 6-((((3s, 5r)-5-(((6-amino-4-methylpyridin-2-yl)methoxy) methyl)pyrrolidin-3-yl)oxy) methyl)-4-methylpyridin-2-amine
PDB Compounds: (A:) Nitric oxide synthase, endothelial

SCOPe Domain Sequences for d4d1pa_:

Sequence, based on SEQRES records: (download)

>d4d1pa_ d.174.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fprvknwevgsitydtlsaqaqqdgpctprrclgslvfprklqgrpspgppapeqllsqa
rdfinqyyssikrsgsqaheqrlqeveaevaatgtyqlreselvfgakqawrnaprcvgr
iqwgklqvfdardcrsaqemftyicnhikyatnrgnlrsaitvfpqrcpgrgdfriwnsq
lvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeppelfllpp
elvlevplehptlewfaalglrwyalpavsnmlleigglefpaapfsgwymsteigtrnl
cdphryniledvavcmdldtrttsslwkdkaaveinvavlhsyqlakvtivdhhaatasf
mkhleneqkarggcpadwawivppisgsltpvfhqemvnyflspafryqpdpw

Sequence, based on observed residues (ATOM records): (download)

>d4d1pa_ d.174.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fprvknwevgsitydtlsaqaqqdgpctprrclgslvfpapeqllsqardfinqyyssik
rsgsqaheqrlqeveaevaatgtyqlreselvfgakqawrnaprcvgriqwgklqvfdar
dcrsaqemftyicnhikyatnrgnlrsaitvfpqrcpgrgdfriwnsqlvryagyrqqdg
svrgdpanveitelciqhgwtpgngrfdvlplllqapdeppelfllppelvlevplehpt
lewfaalglrwyalpavsnmlleigglefpaapfsgwymsteigtrnlcdphryniledv
avcmdldtrttsslwkdkaaveinvavlhsyqlakvtivdhhaatasfmkhleneqkarg
gcpadwawivppisgsltpvfhqemvnyflspafryqpdpw

SCOPe Domain Coordinates for d4d1pa_:

Click to download the PDB-style file with coordinates for d4d1pa_.
(The format of our PDB-style files is described here.)

Timeline for d4d1pa_: