Lineage for d4coqb_ (4coq B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2811457Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2811458Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2812758Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2812759Protein automated matches [191011] (16 species)
    not a true protein
  7. 2812969Species Thermovibrio ammonificans [TaxId:648996] [260302] (1 PDB entry)
  8. 2812971Domain d4coqb_: 4coq B: [260303]
    automated match to d1koqa_
    complexed with cl, pg4, pg6, pge, san, zn

Details for d4coqb_

PDB Entry: 4coq (more details), 1.55 Å

PDB Description: The complex of alpha-Carbonic anhydrase from Thermovibrio ammonificans with inhibitor sulfanilamide.
PDB Compounds: (B:) Carbonate dehydratase

SCOPe Domain Sequences for d4coqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4coqb_ b.74.1.0 (B:) automated matches {Thermovibrio ammonificans [TaxId: 648996]}
ggahwgysgsigpehwgdlspeylmckigknqspidinsadavkaclapvsvyyvsdaky
vvnnghtikvvmggrgyvvvdgkrfylkqfhfhapsehtvngkhypfeahfvhldkngni
tvlgvffkvgkenpelekvwrvmpeepgqkrhltaridpekllpenrdyyrysgslttpp
csegvrwivfkepvemsreqlekfrkvmgfdnnrpvqplnarkvmk

SCOPe Domain Coordinates for d4coqb_:

Click to download the PDB-style file with coordinates for d4coqb_.
(The format of our PDB-style files is described here.)

Timeline for d4coqb_: