Class b: All beta proteins [48724] (180 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.0: automated matches [191576] (1 protein) not a true family |
Protein automated matches [191011] (16 species) not a true protein |
Species Thermovibrio ammonificans [TaxId:648996] [260302] (1 PDB entry) |
Domain d4coqb_: 4coq B: [260303] automated match to d1koqa_ complexed with cl, pg4, pg6, pge, san, zn |
PDB Entry: 4coq (more details), 1.55 Å
SCOPe Domain Sequences for d4coqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4coqb_ b.74.1.0 (B:) automated matches {Thermovibrio ammonificans [TaxId: 648996]} ggahwgysgsigpehwgdlspeylmckigknqspidinsadavkaclapvsvyyvsdaky vvnnghtikvvmggrgyvvvdgkrfylkqfhfhapsehtvngkhypfeahfvhldkngni tvlgvffkvgkenpelekvwrvmpeepgqkrhltaridpekllpenrdyyrysgslttpp csegvrwivfkepvemsreqlekfrkvmgfdnnrpvqplnarkvmk
Timeline for d4coqb_: