Lineage for d4csdb_ (4csd B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2065738Superfamily b.68.8: Fucose-specific lectin [89372] (2 families) (S)
    automatically mapped to Pfam PF07938
  5. 2065746Family b.68.8.0: automated matches [260165] (1 protein)
    not a true family
  6. 2065747Protein automated matches [260166] (1 species)
    not a true protein
  7. 2065748Species Ralstonia solanacearum [TaxId:305] [260167] (1 PDB entry)
  8. 2065750Domain d4csdb_: 4csd B: [260301]
    automated match to d1iuca_
    complexed with gol, mfu

Details for d4csdb_

PDB Entry: 4csd (more details), 1.35 Å

PDB Description: structure of monomeric ralstonia solanacearum lectin
PDB Compounds: (B:) fucose-binding lectin protein

SCOPe Domain Sequences for d4csdb_:

Sequence, based on SEQRES records: (download)

>d4csdb_ b.68.8.0 (B:) automated matches {Ralstonia solanacearum [TaxId: 305]}
ssvqtaatswgtvpsirvytanngkitercwdgkgwytgafnepgdnvsvtswlvgsaih
irvyastgttttewcwdgngwtkgaytsstvpgdqtaatswgtvpsirvytanngkiter
cwdgkgwytgafnepgdnvsvtswlvgsaihirvyastgttttewcwdgngwtkgaytss
tvpgdqtaatswgtvpsirvytanngkitercwdgkgwytgafnepgdnvsvtswlvgsa
ihirvyastgttttewcwdgngwtkgayta

Sequence, based on observed residues (ATOM records): (download)

>d4csdb_ b.68.8.0 (B:) automated matches {Ralstonia solanacearum [TaxId: 305]}
ssvqtaatswgtvpsirvytanngkitercwdgkgwytgafnepgdnvsvtswlvgsaih
irvyastgttttewcwdgngwtkgaytspgdqtaatswgtvpsirvytanngkitercwd
gkgwytgafnepgdnvsvtswlvgsaihirvyastgttttewcwdgngwtkgaytsstvp
gdqtaatswgtvpsirvytanngkitercwdgkgwytgafnepgdnvsvtswlvgsaihi
rvyastgttttewcwdgngwtkgayta

SCOPe Domain Coordinates for d4csdb_:

Click to download the PDB-style file with coordinates for d4csdb_.
(The format of our PDB-style files is described here.)

Timeline for d4csdb_: