Lineage for d4weca_ (4wec A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1831680Species Mycobacterium smegmatis [TaxId:246196] [189539] (5 PDB entries)
  8. 1831685Domain d4weca_: 4wec A: [260294]
    automated match to d4bmnb_
    complexed with edo, mg, nad, zn

Details for d4weca_

PDB Entry: 4wec (more details), 1.55 Å

PDB Description: crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
PDB Compounds: (A:) Short chain dehydrogenase

SCOPe Domain Sequences for d4weca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4weca_ c.2.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
smdltqrlagkvavitggasgiglatgrrlraegatvvvgdidpttgkaaadeleglfvp
vdvseqeavdnlfdtaastfgrvdiafnnagisppeddlientdlpawqrvqdinlksvy
lscraalrhmvpagkgsiintasfvavmgsatsqisytaskggvlamsrelgvqyarqgi
rvnalcpgpvntpllqelfakdperaarrlvhiplgrfaepeelaaavaflasddasfit
gstflvdggissayvtpl

SCOPe Domain Coordinates for d4weca_:

Click to download the PDB-style file with coordinates for d4weca_.
(The format of our PDB-style files is described here.)

Timeline for d4weca_: