Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein automated matches [190057] (26 species) not a true protein |
Species Aspergillus niger [TaxId:5061] [260290] (4 PDB entries) |
Domain d3wh9a_: 3wh9 A: [260291] automated match to d3ziza_ complexed with cl, nag, trs |
PDB Entry: 3wh9 (more details), 1.57 Å
SCOPe Domain Sequences for d3wh9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wh9a_ c.1.8.3 (A:) automated matches {Aspergillus niger [TaxId: 5061]} sfastsglqftidgetgyfagtnsywigfltdnadvdlvmghlkssglkilrvwgfndvt sqpssgtvwyqlhqdgkstintgadglqrldyvvssaeqhdikliinfvnywtdyggmsa yvsayggsgetdfytsdtmqsayqtyiktvverysnssavfawelaneprcpscdtsvly nwiektskfikgldadrmvcigdegfglnidsdgsypyqfseglnftmnldidtidfgtl hlypdswgtsddwgngwitahgaackaagkpclleeygvtsnhcsvegawqktalsttgv gadlfwqygddlstgkspddgntiyygtsdyqclvtdhvaaigsa
Timeline for d3wh9a_: