Lineage for d3wh9a_ (3wh9 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818795Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1819412Protein automated matches [190057] (21 species)
    not a true protein
  7. 1819413Species Aspergillus niger [TaxId:5061] [260290] (1 PDB entry)
  8. 1819414Domain d3wh9a_: 3wh9 A: [260291]
    automated match to d3ziza_
    complexed with cl, nag, trs

Details for d3wh9a_

PDB Entry: 3wh9 (more details), 1.57 Å

PDB Description: the ligand-free structure of manbk from aspergillus niger bk01
PDB Compounds: (A:) endo-beta-1,4-Mannanase

SCOPe Domain Sequences for d3wh9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wh9a_ c.1.8.3 (A:) automated matches {Aspergillus niger [TaxId: 5061]}
sfastsglqftidgetgyfagtnsywigfltdnadvdlvmghlkssglkilrvwgfndvt
sqpssgtvwyqlhqdgkstintgadglqrldyvvssaeqhdikliinfvnywtdyggmsa
yvsayggsgetdfytsdtmqsayqtyiktvverysnssavfawelaneprcpscdtsvly
nwiektskfikgldadrmvcigdegfglnidsdgsypyqfseglnftmnldidtidfgtl
hlypdswgtsddwgngwitahgaackaagkpclleeygvtsnhcsvegawqktalsttgv
gadlfwqygddlstgkspddgntiyygtsdyqclvtdhvaaigsa

SCOPe Domain Coordinates for d3wh9a_:

Click to download the PDB-style file with coordinates for d3wh9a_.
(The format of our PDB-style files is described here.)

Timeline for d3wh9a_: