Lineage for d4wd2a1 (4wd2 A:1-400)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132340Species Burkholderia cenocepacia [TaxId:985076] [260283] (1 PDB entry)
  8. 2132341Domain d4wd2a1: 4wd2 A:1-400 [260284]
    Other proteins in same PDB: d4wd2a2
    automated match to d4f4ea_
    complexed with gol

Details for d4wd2a1

PDB Entry: 4wd2 (more details), 1.95 Å

PDB Description: crystal structure of an aromatic amino acid aminotransferase from burkholderia cenocepacia j2315
PDB Compounds: (A:) Aromatic-amino-acid transaminase TyrB

SCOPe Domain Sequences for d4wd2a1:

Sequence, based on SEQRES records: (download)

>d4wd2a1 c.67.1.0 (A:1-400) automated matches {Burkholderia cenocepacia [TaxId: 985076]}
mfehidaypgdpiltlnenfqkdprdqkvnlsigiyfdaegripvmgavreaetalqrds
gpkpylpmvglaayrdavqslvfgadhparaagriatlqtlggsgalkvgadflkryfpd
sqvwlsdpswenhrfiferagftvntypyydeatgglkfdamlaaidalparsivllhac
chnptgvdldegqweklidviearellpfvdmayqgfgagldadafavrelarrgvptlv
ansfsknfslygervgglsvvcedaaaaervlgqlagavrsnysnpqtygakvvaavlgt
palrkqweeelsamcrriarmrqsihdglrdhvsgealtryvkqrgmftytgltesqvda
lrevhgvyilrsgrmcvaglndsnvgivadaigkvlksga

Sequence, based on observed residues (ATOM records): (download)

>d4wd2a1 c.67.1.0 (A:1-400) automated matches {Burkholderia cenocepacia [TaxId: 985076]}
mfehidaypgdpiltlnenfqkdprdqkvnlsigiyfdaegripvmgavreaetalqrds
gpkpylpmvglaayrdavqslvfgadhparaagriatlqtlggsgalkvgadflkryfpd
sqvwlsdpswenhrfiferagftvntypyydeatgglkfdamlaaidalparsivllhac
chnptgvdldegqweklidviearellpfvdmayqgfgagldadafavrelarrgvptlv
ansfsknfslygervgglsvvcedaaaaervlgqlagavrsnysnpqtygakvvaavlgt
palrkqweeelsamcrriarmrqsihdglrdhvaltryvkqrgmftytgltesqvdalre
vhgvyilrsgrmcvaglndsnvgivadaigkvlksga

SCOPe Domain Coordinates for d4wd2a1:

Click to download the PDB-style file with coordinates for d4wd2a1.
(The format of our PDB-style files is described here.)

Timeline for d4wd2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4wd2a2