![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (43 proteins) |
![]() | Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [50523] (46 PDB entries) |
![]() | Domain d2cgaa_: 2cga A: [26028] |
PDB Entry: 2cga (more details), 1.8 Å
SCOP Domain Sequences for d2cgaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cgaa_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)} cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq tlaan
Timeline for d2cgaa_: