SCOPe 2.05: Domain d4ux6b_: 4ux6 B:

Lineage for d4ux6b_ (4ux6 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)
   automatically mapped to Pfam PF02898

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein automated matches [190421] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187301] (7 PDB entries)

8. Domain d4ux6b_: 4ux6 B: [260272]
   automated match to d2orta_
   complexed with h4b, hem, ywo

Details for d4ux6b_

PDB Entry: 4ux6, 3 Å

PDB Description: the discovery of novel, potent and highly selective inhibitors of inducible nitric oxide synthase (inos)

PDB Compounds: (B:) Nitric oxide synthase, inducible

SCOPe Domain Sequences for d4ux6b_:

Sequence; same for both SEQRES and ATOM records:

>d4ux6b_ d.174.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sclgsimnpksltrgprdkptpleellphaiefinqyygsfkeakieehlarleavtkei
ettgtyqltldelifatkmawrnaprcigriqwsnlqvfdarncstaqemfqhicrhily
atnngnirsaitvfpqrsdgkhdfrlwnsqliryagyqmpdgtirgdaatleftqlcidl
gwkprygrfdvlplvlqadgqdpevfeippdlvlevtmehpkyewfqelglkwyalpava
nmllevgglefpacpfngwymgteigvrdfcdtqrynileevgrrmglethtlaslwkdr
avteinvavlhsfqkqnvtimdhhtasesfmkhmqneyrarggcpadwiwlvppvsgsit
pvfhqemlnyvlspfyyyqiepwkthiwq

Timeline for d4ux6b_:

• d4ux6b_ first appeared in SCOPe 2.04
  
• d4ux6b_ appears in SCOPe 2.06
  
• d4ux6b_ appears in the current release, SCOPe 2.08