Lineage for d4usaa2 (4usa A:81-193)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2324036Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 2324037Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 2324038Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 protein domains)
  6. 2324045Protein Aldehyde oxidoreductase, domain 2 [47743] (2 species)
  7. 2324048Species Desulfovibrio gigas [TaxId:879] [47744] (12 PDB entries)
    Uniprot Q46509
  8. 2324050Domain d4usaa2: 4usa A:81-193 [260264]
    Other proteins in same PDB: d4usaa1, d4usaa3, d4usaa4
    automated match to d1vlba1
    complexed with bct, cl, fes, hci, ipa, mg, pcd

Details for d4usaa2

PDB Entry: 4usa (more details), 1.13 Å

PDB Description: aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde
PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d4usaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4usaa2 a.56.1.1 (A:81-193) Aldehyde oxidoreductase, domain 2 {Desulfovibrio gigas [TaxId: 879]}
qpenlhplqkawvlhggaqcgfcspgfivsakglldtnadpsredvrdwfqkhrnacrct
gykplvdavmdaaavingkkpetdlefkmpadgriwgskyprptavakvtgtl

SCOPe Domain Coordinates for d4usaa2:

Click to download the PDB-style file with coordinates for d4usaa2.
(The format of our PDB-style files is described here.)

Timeline for d4usaa2: