Lineage for d4us9a1 (4us9 A:1-80)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1894040Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1894211Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 1894218Protein Aldehyde oxidoreductase, N-terminal domain [54315] (2 species)
  7. 1894221Species Desulfovibrio gigas [TaxId:879] [54316] (11 PDB entries)
    Uniprot Q46509
  8. 1894225Domain d4us9a1: 4us9 A:1-80 [260259]
    Other proteins in same PDB: d4us9a2, d4us9a3, d4us9a4
    automated match to d1vlba2
    complexed with 3pl, bct, cl, fes, mg, pcd

Details for d4us9a1

PDB Entry: 4us9 (more details), 1.4 Å

PDB Description: aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde
PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d4us9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4us9a1 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]}
miqkvitvngieqnlfvdaeallsdvlrqqlgltgvkvgceqgqcgacsvildgkvvrac
vtkmkrvadgaqittiegvg

SCOPe Domain Coordinates for d4us9a1:

Click to download the PDB-style file with coordinates for d4us9a1.
(The format of our PDB-style files is described here.)

Timeline for d4us9a1: