Lineage for d4uoea_ (4uoe A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864482Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1864483Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1865706Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1865707Protein automated matches [190689] (49 species)
    not a true protein
  7. 1865904Species Plasmodium falciparum [TaxId:36329] [187826] (15 PDB entries)
  8. 1865941Domain d4uoea_: 4uoe A: [260258]
    automated match to d2i7ca_
    complexed with 1pg, 4zy, gol, mta

Details for d4uoea_

PDB Entry: 4uoe (more details), 2.05 Å

PDB Description: crystal structure of plasmodium falciparum spermidine synthase in complex with 5'-deoxy-5'-methylioadenosine and 4-aminomethylaniline
PDB Compounds: (A:) spermidine synthase

SCOPe Domain Sequences for d4uoea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uoea_ c.66.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
kkwfsefsimwpgqafslkikkilyetkskyqnvlvfesttygkvlvldgviqltekdef
ayhemmthvpmtvskepknvlvvgggdggiirelckyksvenidiceidetvievskiyf
kniscgyedkrvnvfiedaskflenvtntydviivdssdpigpaetlfnqnfyekiynal
kpngycvaqceslwihvgtiknmigyakklfkkveyanisiptypcgcigilccsktdtg
ltkpnkkleskefadlkyynyenhsaafklpafllkeieni

SCOPe Domain Coordinates for d4uoea_:

Click to download the PDB-style file with coordinates for d4uoea_.
(The format of our PDB-style files is described here.)

Timeline for d4uoea_: