Lineage for d5chaa_ (5cha A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 14910Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (2 species)
  7. 14911Species Cow (Bos taurus) [TaxId:9913] [50523] (42 PDB entries)
  8. 14920Domain d5chaa_: 5cha A: [26025]

Details for d5chaa_

PDB Entry: 5cha (more details), 1.67 Å

PDB Description: the refinement and the structure of the dimer of alpha-*chymotrypsin at 1.67-*angstroms resolution

SCOP Domain Sequences for d5chaa_:

Sequence, based on SEQRES records: (download)

>d5chaa_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)}
cgvpaiqpvlsglxxivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
vclpsasddfaagttcvttgwgltryxxantpdrlqqaslpllsntnckkywgtkikdam
icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
tlaan

Sequence, based on observed residues (ATOM records): (download)

>d5chaa_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)}
cgvpaiqpvivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsdvv
vagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclpsa
sddfaagttcvttgwgltryantpdrlqqaslpllsntnckkywgtkikdamicagasgv
sscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

SCOP Domain Coordinates for d5chaa_:

Click to download the PDB-style file with coordinates for d5chaa_.
(The format of our PDB-style files is described here.)

Timeline for d5chaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5chab_