SCOPe 2.08: Domain d4tvpe2: 4tvp E:108-210

Lineage for d4tvpe2 (4tvp E:108-210)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4tvpe2: 4tvp E:108-210 [260249]
   Other proteins in same PDB: d4tvpe1, d4tvph_, d4tvpl1, d4tvpl2
   automated match to d2fb4l2
   complexed with nag, so4

Details for d4tvpe2

PDB Entry: 4tvp, 3.1 Å

PDB Description: crystal structure of the hiv-1 bg505 sosip.664 env trimer ectodomain, comprising atomic-level definition of pre-fusion gp120 and gp41, in complex with human antibodies pgt122 and 35o22

PDB Compounds: (E:) 35O22 Light chain

SCOPe Domain Sequences for d4tvpe2:

Sequence; same for both SEQRES and ATOM records:

>d4tvpe2 b.1.1.2 (E:108-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qskanpsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapte

Timeline for d4tvpe2:

• d4tvpe2 first appeared in SCOPe 2.04
  
• d4tvpe2 appears in SCOPe 2.07