SCOPe 2.04: Domain d4tvpe1: 4tvp E:2-107

Lineage for d4tvpe1 (4tvp E:2-107)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d4tvpe1: 4tvp E:2-107 [260248]
   Other proteins in same PDB: d4tvpe2
   automated match to d2mcg11
   complexed with nag, so4

Details for d4tvpe1

PDB Entry: 4tvp, 3.1 Å

PDB Description: crystal structure of the hiv-1 bg505 sosip.664 env trimer ectodomain, comprising atomic-level definition of pre-fusion gp120 and gp41, in complex with human antibodies pgt122 and 35o22

PDB Compounds: (E:) 35O22 Light chain

SCOPe Domain Sequences for d4tvpe1:

Sequence; same for both SEQRES and ATOM records:

>d4tvpe1 b.1.1.0 (E:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqsasvsgslgqsvtisctgpnsvccshksiswyqwppgraptliiyednerapgis
prfsgyksywsayltisdlrpedettyyccsythnsgcvfgtgtkvsvlg

Timeline for d4tvpe1:

• d4tvpe1 is new in SCOPe 2.04-stable
  
• d4tvpe1 appears in SCOPe 2.05
  
• d4tvpe1 appears in the current release, SCOPe 2.08