Lineage for d4tvpe1 (4tvp E:2-107)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2357495Domain d4tvpe1: 4tvp E:2-107 [260248]
    Other proteins in same PDB: d4tvpe2
    automated match to d2mcg11
    complexed with bma, man, nag, so4

Details for d4tvpe1

PDB Entry: 4tvp (more details), 3.1 Å

PDB Description: crystal structure of the hiv-1 bg505 sosip.664 env trimer ectodomain, comprising atomic-level definition of pre-fusion gp120 and gp41, in complex with human antibodies pgt122 and 35o22
PDB Compounds: (E:) 35O22 Light chain

SCOPe Domain Sequences for d4tvpe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tvpe1 b.1.1.0 (E:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqsasvsgslgqsvtisctgpnsvccshksiswyqwppgraptliiyednerapgis
prfsgyksywsayltisdlrpedettyyccsythnsgcvfgtgtkvsvlg

SCOPe Domain Coordinates for d4tvpe1:

Click to download the PDB-style file with coordinates for d4tvpe1.
(The format of our PDB-style files is described here.)

Timeline for d4tvpe1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4tvpe2