Lineage for d4tqok_ (4tqo K:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2346684Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2346747Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) (S)
    consists of single alpha-helix and irregular N-terminal tail
    automatically mapped to Pfam PF02315
  5. 2346748Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)
  6. 2346775Protein automated matches [190583] (3 species)
    not a true protein
  7. 2346780Species Methylococcus capsulatus [TaxId:243233] [260039] (5 PDB entries)
  8. 2346807Domain d4tqok_: 4tqo K: [260246]
    Other proteins in same PDB: d4tqoa_, d4tqob_, d4tqoc_, d4tqod_, d4tqoe_, d4tqof_, d4tqog_, d4tqoh_
    automated match to d1w6sb_
    complexed with ca, pqq

Details for d4tqok_

PDB Entry: 4tqo (more details), 2.57 Å

PDB Description: the crystal structure of methanol dehydrogenase from methylococcus capsulatus (bath)
PDB Compounds: (K:) Methanol dehydrogenase, small subunit

SCOPe Domain Sequences for d4tqok_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tqok_ a.137.2.1 (K:) automated matches {Methylococcus capsulatus [TaxId: 243233]}
ydgthckapgncwepkpgypdkvagskydpkhdpnelnkqaesikamearnqkrvenyak
tgkfvykvedi

SCOPe Domain Coordinates for d4tqok_:

Click to download the PDB-style file with coordinates for d4tqok_.
(The format of our PDB-style files is described here.)

Timeline for d4tqok_: