SCOPe 2.04: Domain d4tqok_: 4tqo K:

Lineage for d4tqok_ (4tqo K:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family)
   consists of single alpha-helix and irregular N-terminal tail
   automatically mapped to Pfam PF02315

5. Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)

6. Protein automated matches [190583] (2 species)
   not a true protein

7. Species Methylococcus capsulatus [TaxId:243233] [260039] (1 PDB entry)

8. Domain d4tqok_: 4tqo K: [260246]
   Other proteins in same PDB: d4tqoc_
   automated match to d1w6sb_
   complexed with ca, pqq

Details for d4tqok_

PDB Entry: 4tqo, 2.57 Å

PDB Description: the crystal structure of methanol dehydrogenase from methylococcus capsulatus (bath)

PDB Compounds: (K:) Methanol dehydrogenase, small subunit

SCOPe Domain Sequences for d4tqok_:

Sequence; same for both SEQRES and ATOM records:

>d4tqok_ a.137.2.1 (K:) automated matches {Methylococcus capsulatus [TaxId: 243233]}
ydgthckapgncwepkpgypdkvagskydpkhdpnelnkqaesikamearnqkrvenyak
tgkfvykvedi

Timeline for d4tqok_:

• d4tqok_ is new in SCOPe 2.04-stable
  
• d4tqok_ appears in SCOPe 2.05
  
• d4tqok_ appears in the current release, SCOPe 2.08