SCOPe 2.04: Domain d4rcha1: 4rch A:14-218

Lineage for d4rcha1 (4rch A:14-218)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (42 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224896] (40 PDB entries)

8. Domain d4rcha1: 4rch A:14-218 [260242]
   automated match to d4isea1
   complexed with 3lz, glc

Details for d4rcha1

PDB Entry: 4rch, 2.3 Å

PDB Description: discovery of 2-pyridyl ureas as glucokinase activators

PDB Compounds: (A:) Glucokinase

SCOPe Domain Sequences for d4rcha1:

Sequence; same for both SEQRES and ATOM records:

>d4rcha1 c.55.1.0 (A:14-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tlveqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlptyvrstpegsevgd
flsldlggtnfrvmlvkvgegeegqwsvktkhqmysipedamtgtaemlfdyisecisdf
ldkhqmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrdaikrrg
dfemdvvamvndtvatmiscyyedh

Timeline for d4rcha1:

• d4rcha1 is new in SCOPe 2.04-stable
  
• d4rcha1 appears in SCOPe 2.05
  
• d4rcha1 appears in the current release, SCOPe 2.08