Lineage for d4r26l2 (4r26 L:108-209)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758262Domain d4r26l2: 4r26 L:108-209 [260239]
    Other proteins in same PDB: d4r26h2, d4r26l3
    automated match to d4k3dl2
    complexed with gol

Details for d4r26l2

PDB Entry: 4r26 (more details), 2.5 Å

PDB Description: crystal structure of human fab pgt124, a broadly neutralizing and potent hiv-1 neutralizing antibody
PDB Compounds: (L:) PGR124-Light Chain

SCOPe Domain Sequences for d4r26l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r26l2 b.1.1.0 (L:108-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvapt

SCOPe Domain Coordinates for d4r26l2:

Click to download the PDB-style file with coordinates for d4r26l2.
(The format of our PDB-style files is described here.)

Timeline for d4r26l2: