Class b: All beta proteins [48724] (177 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186914] (54 PDB entries) |
Domain d4pnka3: 4pnk A:550-668 [260233] Other proteins in same PDB: d4pnka1, d4pnka2, d4pnkb_, d4pnkg_ automated match to d3krxa3 complexed with kzq |
PDB Entry: 4pnk (more details), 2.56 Å
SCOPe Domain Sequences for d4pnka3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pnka3 b.55.1.0 (A:550-668) automated matches {Human (Homo sapiens) [TaxId: 9606]} eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv eetqikerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkp
Timeline for d4pnka3: