![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
![]() | Protein automated matches [190052] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186914] (36 PDB entries) |
![]() | Domain d4pnka3: 4pnk A:550-668 [260233] Other proteins in same PDB: d4pnka1, d4pnka2, d4pnkb_, d4pnkg_ automated match to d3krxa3 complexed with kzq |
PDB Entry: 4pnk (more details), 2.56 Å
SCOPe Domain Sequences for d4pnka3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pnka3 b.55.1.0 (A:550-668) automated matches {Human (Homo sapiens) [TaxId: 9606]} eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv eetqikerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkp
Timeline for d4pnka3: