SCOPe 2.04: Domain d4pnka3: 4pnk A:550-668

Lineage for d4pnka3 (4pnk A:550-668)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (32 PDB entries)

8. Domain d4pnka3: 4pnk A:550-668 [260233]
   Other proteins in same PDB: d4pnka1, d4pnka2, d4pnkb_, d4pnkg_
   automated match to d3krxa3
   complexed with kzq

Details for d4pnka3

PDB Entry: 4pnk, 2.56 Å

PDB Description: g protein-coupled receptor kinase 2 in complex with gsk180736a

PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d4pnka3:

Sequence; same for both SEQRES and ATOM records:

>d4pnka3 b.55.1.0 (A:550-668) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv
eetqikerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkp

Timeline for d4pnka3:

• d4pnka3 is new in SCOPe 2.04-stable
  
• d4pnka3 appears in SCOPe 2.05
  
• d4pnka3 appears in the current release, SCOPe 2.08