SCOPe 2.06: Domain d4pnka1: 4pnk A:30-185

Lineage for d4pnka1 (4pnk A:30-185)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187381] (30 PDB entries)

8. Domain d4pnka1: 4pnk A:30-185 [260231]
   Other proteins in same PDB: d4pnka2, d4pnka3, d4pnkb_, d4pnkg_
   automated match to d3krxa1
   complexed with kzq

Details for d4pnka1

PDB Entry: 4pnk, 2.56 Å

PDB Description: g protein-coupled receptor kinase 2 in complex with gsk180736a

PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d4pnka1:

Sequence; same for both SEQRES and ATOM records:

>d4pnka1 a.91.1.0 (A:30-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclnhleearplvefyeei
kkyekleteeervarsreifdsyimkellacshpfsksatehvqghlgkkqvppdlfqpy
ieeicqnlrgdvfqkfiesdkftrfcqwknvelnih

Timeline for d4pnka1:

• d4pnka1 first appeared in SCOPe 2.04
  
• d4pnka1 appears in SCOPe 2.05
  
• d4pnka1 appears in SCOPe 2.07
  
• d4pnka1 appears in the current release, SCOPe 2.08