![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
![]() | Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) ![]() long alpha-helix interrupted in the middle automatically mapped to Pfam PF00631 |
![]() | Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins) |
![]() | Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [48673] (28 PDB entries) |
![]() | Domain d4pnkg_: 4pnk G: [260227] Other proteins in same PDB: d4pnka1, d4pnka2, d4pnka3, d4pnkb_ automated match to d1gg2g_ complexed with kzq |
PDB Entry: 4pnk (more details), 2.56 Å
SCOPe Domain Sequences for d4pnkg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pnkg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]} asiaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfrekkf fs
Timeline for d4pnkg_:
![]() Domains from other chains: (mouse over for more information) d4pnka1, d4pnka2, d4pnka3, d4pnkb_ |